FKBP3 Antibody - C-terminal region : Biotin

FKBP3 Antibody - C-terminal region : Biotin
Artikelnummer
AVIARP54612_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: FKBP3 is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. FKBP3 is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin, as well as histone deacetylases, the transcription factor YY1, casein kinase II, and nucleolin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.The protein encoded by this gene is a member of the immunophilin protein family, which play a role in immunoregulation and basic cellular processes involving protein folding and trafficking. This encoded protein is a cis-trans prolyl isomerase that binds the immunosuppressants FK506 and rapamycin. It has a higher affinity for rapamycin than for FK506 and thus may be an important target molecule for immunosuppression by rapamycin.

Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FKBP3

Key Reference: Meng,X., Biochem. Genet. 40 (9-10), 303-310 (2002)

Molecular Weight: 25kDa

Peptide Sequence: Synthetic peptide located within the following region: EALLTMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLTFEVELVDID

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Peptidyl-prolyl cis-trans isomerase FKBP3

Protein Size: 224

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54612_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54612_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2287
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×