FLII Antibody - middle region : FITC

FLII Antibody - middle region : FITC
Artikelnummer
AVIARP54614_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FLII is a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. This gene is located within the Smith-Magenis syndrome region on chromosome 17.This gene encodes a protein with a gelsolin-like actin binding domain and an N-terminal leucine-rich repeat-protein protein interaction domain. The protein is similar to a Drosophila protein involved in early embryogenesis and the structural organization of indirect flight muscle. The gene is located within the Smith-Magenis syndrome region on chromosome 17. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FLII

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 145kDa

Peptide Sequence: Synthetic peptide located within the following region: LAEDILNTMFDTSYSKQVINEGEEPENFFWVGIGAQKPYDDDAEYMKHTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein flightless-1 homolog

Protein Size: 1269

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP54614_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP54614_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 2314
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×