FLJ14803 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The specific function of FLJ14803 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14803

Key Reference: Yamada,T., (2004) Genomics 83 (3), 402-412

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protein 209

Protein Size: 561

Purification: Affinity Purified

• Artikelnummer: AVIARP58694_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58694_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 84928
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin