FLJ14803 Antibody - N-terminal region : FITC

FLJ14803 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58694_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FLJ14803 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ14803

Key Reference: Yamada,T., (2004) Genomics 83 (3), 402-412

Molecular Weight: 62kDa

Peptide Sequence: Synthetic peptide located within the following region: MMQGEAHPSASLIDRTIKMRKETEARKVVLAWGLLNVSMAGMIYTEMTGK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transmembrane protein 209

Protein Size: 561

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58694_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58694_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 84928
Wirt Rabbit
Konjugat Conjugated, FITC
Produktinformation (PDF) Download
MSDS (PDF)
×