FLJ20433 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The specific function of FLJ20433 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433

Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Probable exonuclease mut-7 homolog

Protein Size: 758

Purification: Affinity Purified

• Artikelnummer: AVIARP58623_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58623_P050-FITC
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Goat (Caprine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54932
• Wirt: Rabbit
• Konjugat: Conjugated, FITC