FLJ36070 Antibody - N-terminal region : FITC

FLJ36070 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP55828_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FLJ36070 is a transcriptional coactivator.FLJ36070 stimulates the transcriptional activity of MEF2C. FLJ36070 stimulates MYOD1 activity in part via MEF2, resulting in an enhancement of skeletal muscle differentiation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ36070

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: QPHPRMKPSPLTPCPPGVPSPSPPPHKLELQTLKLEELTVSELRQQLRLR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: MEF2-activating motif and SAP domain-containing transcriptional regulator

Protein Size: 312

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55828_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55828_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 284358
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×