FLJ37543 Antibody - N-terminal region : HRP

FLJ37543 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP55683_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The exact functions of FLJ37543 remain unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ37543

Key Reference: Ota,T., (2004) Nat. Genet. 36 (1), 40-45

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: MLAPLFLCCLRNLFRKLISFQPPQLGRTNMHYSKLPRTAIETEFKQNVGP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Uncharacterized protein C5orf64

Protein Size: 130

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP55683_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP55683_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 285668
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×