Fntb Antibody - N-terminal region : Biotin

Fntb Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58467_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Fntb is a beta subunit of a transferase enzyme; attaches a farnesyl group to cysteine in ras and other membrane-associated proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fntb

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein farnesyltransferase subunit beta

Protein Size: 437

Purification: Affinity Purified

Subunit: beta
Mehr Informationen
Artikelnummer AVIARP58467_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58467_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64511
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×