Fntb Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Fntb is a beta subunit of a transferase enzyme; attaches a farnesyl group to cysteine in ras and other membrane-associated proteins.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Fntb

Molecular Weight: 48kDa

Peptide Sequence: Synthetic peptide located within the following region: PEHARERLQDDSVETVTSIEQAKVEEKIQEVFSSYKFNHLVPRLVLQREK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein farnesyltransferase subunit beta

Protein Size: 437

Purification: Affinity Purified

Subunit: beta

• Artikelnummer: AVIARP58467_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58467_P050-Biotin
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 64511
• Wirt: Rabbit
• Konjugat: Conjugated, Biotin