Acin1 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Acin1

Molecular Weight: 60kDa

Peptide Sequence: Synthetic peptide located within the following region: RSEREWDRDKVREGPRSRSRSRDRRRKERAKSKEKKSEKKEKAQEEPPAK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Acin1 protein EMBL AAH94217.1

Protein Size: 552

Purification: Affinity Purified

• Artikelnummer: AVIARP58257_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58257_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 56215
• Wirt: Rabbit