ACTR3B Antibody - N-terminal region : Biotin

ACTR3B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57420_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: ACTR3B plays a role in the organization of the actin cytoskeleton.ACTR3B may function as ATP-binding component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. ACTR3B may decrease the metastatic potential of tumors.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACTR3B

Molecular Weight: 47kDa

Peptide Sequence: Synthetic peptide located within the following region: DHYFLMTEPPLNTPENREYLAEIMFESFNVPGLYIAVQAVLALAASWTSR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Actin-related protein 3B

Protein Size: 418

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57420_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57420_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57180
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×