APEX1 Antibody - middle region : Biotin

APEX1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58028_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Apurinic/apyrimidinic (AP) sites occur frequently in DNA molecules by spontaneous hydrolysis, by DNA damaging agents or by DNA glycosylases that remove specific abnormal bases. AP sites are pre-mutagenic lesions that can prevent normal DNA replication so the cell contains systems to identify and repair such sites. Class II AP endonucleases cleave the phosphodiester backbone 5' to the AP site. This gene encodes the major AP endonuclease in human cells. Splice variants have been found for this gene; all encode the same protein.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human APEX1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: HEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: DNA-(apurinic or apyrimidinic site) lyase

Protein Size: 318

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58028_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58028_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting, Immunohistochemistry
Human Gene ID 328
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×