ASF1A Antibody - N-terminal region : Biotin

ASF1A Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58260_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene encodes a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The protein is a key component of a histone donor complex that functions in nucleosome assembly. It interacts with histones H3 and H4, and functions together with a chromatin assembly factor during DNA replication and repair.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ASF1A

Molecular Weight: 23kDa

Peptide Sequence: Synthetic peptide located within the following region: MAKVQVNNVVVLDNPSPFYNPFQFEITFECIEDLSEDLEWKIIYVGSAES

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Histone chaperone ASF1A

Protein Size: 204

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58260_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58260_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Sheep (Ovine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Goat (Caprine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25842
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×