ATG16L1 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: Autophagy is the major intracellular degradation system delivering cytoplasmic components to lysosomes, and it accounts for degradation of most long-lived proteins and some organelles. Cytoplasmic constituents, including organelles, are sequestered into double-membraned autophagosomes, which subsequently fuse with lysosomes. ATG16L1 is a component of a large protein complex essential for autophagy.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ATG16L1

Molecular Weight: 29kDa

Peptide Sequence: Synthetic peptide located within the following region: TRRSVSSFPVPQDNVDTHPGSGKEVRVPATALCVFDAHDGEVNAVQFSPG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Autophagy-related protein 16-1

Protein Size: 266

Purification: Affinity Purified

• Artikelnummer: AVIARP58925_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58925_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55054
• Wirt: Rabbit