Aup1 Antibody - N-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Aup1

Molecular Weight: 49kDa

Peptide Sequence: Synthetic peptide located within the following region: MPKDSAFPGAPAALRRWRRQRPRSPEAAAMEPPPAPGPERLFDSHRLPSD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Ancient ubiquitous protein 1 Ensembl ENSMUSP00000090281

Protein Size: 439

Purification: Affinity Purified

• Artikelnummer: AVIARP57778_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57778_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 11993
• Wirt: Rabbit