BUB3 Antibody - N-terminal region : FITC

BUB3 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58599_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: BUB3 is required for kinetochore localization of BUB1.This gene encodes a protein involved in spindle checkpoint function. The encoded protein contains four WD repeat domains and has sequence similarity with the yeast BUB3 protein. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human BUB3

Key Reference: Vaclavicek,A., (2007) Breast Cancer Res. Treat. 106 (2), 205-213

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mitotic checkpoint protein BUB3

Protein Size: 326

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58599_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58599_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Immunofluorescence, Western Blotting, Immunohistochemistry
Human Gene ID 9184
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×