CCDC76 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: CCDC76 specifically methylates guanosine-4 in various tRNAs with a Gly(CCG), His or Pro signature.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CCDC76

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: QLAKHLKKCNSREKPKPDFYIQDINAGLRDETEIPEQLVPISSLSEEQLE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: tRNA guanosine-2'-O-methyltransferase TRM13 homolog

Protein Size: 481

Purification: Affinity Purified

• Artikelnummer: AVIARP57327_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57327_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54482
• Wirt: Rabbit