CDCA7L Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: CDCA7L plays a role in transcriptional regulation as a repressor that inhibits monoamine oxidase A (MAOA) activity and gene expression by binding to the promoter.CDCA7L plays an important oncogenic role in mediating the full transforming effect of MYC in medulloblastoma cells. CDCA7L is involved in apoptotic signaling pathways. CDCA7L may act downstream of P38-kinase and BCL-2, but upstream of CASP3/caspase-3 as well as CCND1/cyclin D1 and E2F1.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CDCA7L

Molecular Weight: 46kDa

Peptide Sequence: Synthetic peptide located within the following region: PPCRGICNCSYCRKRDGRCATGILIHLAKFYGYDNVKEYLESLQKELVED

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Cell division cycle-associated 7-like protein

Protein Size: 420

Purification: Affinity Purified

• Artikelnummer: AVIARP57292_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57292_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 55536
• Wirt: Rabbit