English
CDK5RAP1 Antibody - N-terminal region : HRP
CDK5RAP1 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56906_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1
Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: CDK5 regulatory subunit-associated protein 1
Protein Size: 497
Purification: Affinity Purified
Subunit: -associated protein 1
Description of Target: Neuronal CDC2-like kinase, which is involved in the regulation of neuronal differentiation, is composed of a catalytic subunit, CDK5, and an activating subunit, p25NCK5A. The protein encoded by this gene binds to p25NCK5A and therefore may be involved in
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CDK5RAP1
Key Reference: Lehner,B. (2004) Genome Res. 14 (7), 1315-1323
Molecular Weight: 55kDa
Peptide Sequence: Synthetic peptide located within the following region: MMDELLGRQRKVYLETYGCQMNVNDTEIAWSILQKSGYLRTSNLQEADVI
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: CDK5 regulatory subunit-associated protein 1
Protein Size: 497
Purification: Affinity Purified
Subunit: -associated protein 1
| Artikelnummer | AVIARP56906_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP56906_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 51654 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
