CHCHD8 Antibody - middle region : FITC

CHCHD8 Antibody - middle region : FITC
Artikelnummer
AVIARP56948_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The function of CHCHD8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHCHD8

Molecular Weight: 10kDa

Peptide Sequence: Synthetic peptide located within the following region: SHFAVQECMAQHQDWRQCQPQVQAFKDCMSEQQARRQEELQRRQEQAGAH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Cytochrome c oxidase assembly factor 4 homolog, mitochondrial

Protein Size: 87

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56948_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56948_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51287
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×