EIF4ENIF1 Antibody - N-terminal region : Biotin

EIF4ENIF1 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57350_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene is a nucleocytoplasmic shuttle protein for the translation initiation factor eIF4E. This shuttle protein interacts with the importin alpha-beta complex to mediate nuclear import of eIF4E. It is predominantly cytoplasmic; its own nuclear import is regulated by a nuclear localization signal and nuclear export signals. Multiple transcript variants encoding different isoforms have been found for this gene.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human EIF4ENIF1

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: TEEEPEWFSAGPTSQSETIELTGFDDKILEEDHKGRKRTRRRTASVKEGI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Eukaryotic translation initiation factor 4E transporter

Protein Size: 985

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57350_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57350_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 56478
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×