Erg Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Erg is a transcriptional regulator. It may participate in transcriptional regulation through the recruitment of SETDB1 histone methyltransferase and subsequent modification of local chromatin structure.

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: FKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAY

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Transcriptional regulator ERG

Protein Size: 486

Purification: Affinity Purified

• Artikelnummer: AVIARP57968_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57968_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 13876
• Wirt: Rabbit