EVX1 Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: EVX1 is a member of the vertebrate eve-related homeo box family. This protein acts as a transcriptional repressor. A similar protein in mice is critical for early embryogenesis. This gene encodes a member of the even-skipped homeobox family characterized by the presence of a homeodomain closely related to the Drosophila even-skipped (eve) segmentation gene of the pair-rule class. The encoded protein may play an important role as a transcriptional repressor during embryogenesis. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-343 AC004080.2 115915-116257 344-1717 X60655.1 86-1459 1718-1858 AC004080.2 119803-119943

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human EVX1

Key Reference: Briata,P., (1995) J. Biol. Chem. 270 (46), 27695-27701

Molecular Weight: 42kDa

Peptide Sequence: Synthetic peptide located within the following region: GSGSEALVGSPNGGSETPKSNGGSGGGGSQGTLACSASDQMRRYRTAFTR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Homeobox even-skipped homolog protein 1

Protein Size: 407

Purification: Affinity Purified

• Artikelnummer: AVIARP57972_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57972_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 2128
• Wirt: Rabbit