FAM29A Antibody - middle region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: FAM29A is required for progression through mitosis. FAM29A promotes the nucleation of microtubules from the spindle through recruitment of NEDD1 and gamma-tubulin.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM29A

Molecular Weight: 108kDa

Peptide Sequence: Synthetic peptide located within the following region: RSLSPLIKFSPVEQRLRTTIACSLGELPNLKEEDILNKSLDAKEPPSDLT

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HAUS augmin-like complex subunit 6

Protein Size: 955

Purification: Affinity Purified

Subunit: 6

• Artikelnummer: AVIARP56990_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56990_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rabbit, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54801
• Wirt: Rabbit