English
FLJ20433 Antibody - N-terminal region : HRP
FLJ20433 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP58623_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase
Description of Target: The specific function of FLJ20433 is not yet known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433
Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
Molecular Weight: 83kDa
Peptide Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Probable exonuclease mut-7 homolog
Protein Size: 758
Purification: Affinity Purified
Description of Target: The specific function of FLJ20433 is not yet known.
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FLJ20433
Key Reference: Kimura,K., (2006) Genome Res. 16 (1), 55-65
Molecular Weight: 83kDa
Peptide Sequence: Synthetic peptide located within the following region: MGPAGCAFTLLLLLGISVCGQPVYSSRVVGGQDAAAGRWPWQVSLHFDHN
Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Protein Name: Probable exonuclease mut-7 homolog
Protein Size: 758
Purification: Affinity Purified
| Artikelnummer | AVIARP58623_P050-HRP |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58623_P050-HRP |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Goat (Caprine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 54932 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
