FNDC8 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of FNDC8 remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FNDC8

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: MASEALHQVGDGEEAVLKKENFNMMNALDQLPKPFSNPKSMNRTVTTKGL

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Fibronectin type III domain-containing protein 8

Protein Size: 324

Purification: Affinity Purified

• Artikelnummer: AVIARP56975_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56975_P050-HRP
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 54752
• Wirt: Rabbit