Frs3 Antibody - C-terminal region : FITC

Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: Frs3 is an adapter protein that links FGR and NGF receptors to downstream signaling pathways. It is involved in the activation of MAP kinases. Frs3 Down-regulates ERK2 signaling by interfering with the phosphorylation and nuclear translocation of ERK2.

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Frs3

Molecular Weight: 54kDa

Peptide Sequence: Synthetic peptide located within the following region: APGPTPHPVRSSDSYAVIDLKKTAAMSDLQRALPRDDGAVRKTRHNSTDL

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Fibroblast growth factor receptor substrate 3

Protein Size: 492

Purification: Affinity Purified

• Artikelnummer: AVIARP58468_P050FITC
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58468_P050-FITC
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 107971
• Wirt: Rabbit