GAPDH Antibody - middle region : FITC

GAPDH Antibody - middle region : FITC
Artikelnummer
AVIARP58580_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: GAPDH catalyzes an important energy-yielding step in carbohydrate metabolism, the reversible oxidative phosphorylation of glyceraldehyde-3-phosphate in the presence of inorganic phosphate and nicotinamide adenine dinucleotide (NAD). The enzyme exists as a

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GAPDH

Key Reference: Rinne,T., (2008) Hum. Mol. Genet. 17 (13), 1968-1977

Molecular Weight: 36kDa

Peptide Sequence: Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glyceraldehyde-3-phosphate dehydrogenase

Protein Size: 335

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58580_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58580_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 2597
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×