GLRX5 Antibody - middle region : Biotin

GLRX5 Antibody - middle region : Biotin
Artikelnummer
AVIARP56908_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: Defects in GLRX5 are the cause of anemia sideroblastic pyridoxine-refractory autosomal recessive (PRARSA). The specific function of GLRX5 is not yet known.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GLRX5

Key Reference: Camaschella,C., (2007) Blood 110 (4), 1353-1358

Molecular Weight: 16kDa

Peptide Sequence: Synthetic peptide located within the following region: NAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVG

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Glutaredoxin-related protein 5, mitochondrial

Protein Size: 157

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56908_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56908_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 51218
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×