Gtf2b Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: Gtf2b is a putative subunit of RNA polymerase II.

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: GAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRT

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Transcription initiation factor IIB

Protein Size: 316

Purification: Affinity Purified

• Artikelnummer: AVIARP58005_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58005_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 81673
• Wirt: Rabbit