HLX Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: HLX is a transcription factor required for TBX21/T-bet-dependent maturation of Th1 cells as well as maintenance of Th1-specific gene expression. Involved in embryogenesis and hematopoiesis.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HLX

Molecular Weight: 51kDa

Peptide Sequence: Synthetic peptide located within the following region: WFQNRRMKWRHSKEAQAQKDKDKEAGEKPSGGAPAADGEQDERSPSRSEG

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: H2.0-like homeobox protein

Protein Size: 488

Purification: Affinity Purified

• Artikelnummer: AVIARP58016_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58016_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Yeast, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 3142
• Wirt: Rabbit