HS1BP3 Antibody - N-terminal region : Biotin

HS1BP3 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP57633_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The protein encoded by this gene shares similarity with mouse Hs1bp3, an Hcls1/Hs1-interacting protein that may be involved in lymphocyte activation.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HS1BP3

Molecular Weight: 43kDa

Peptide Sequence: Synthetic peptide located within the following region: YSEIEEFYQKLSSRYAAASLPPLPRKVLFVGESDIRERRAVFNEILRCVS

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: HCLS1-binding protein 3

Protein Size: 392

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57633_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57633_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 64342
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×