Hsp90ab1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: Hsp90ab1 is a molecular chaperone that promotes the maturation, structural maintenance and proper regulation of specific target proteins involved for instance in cell cycle control and signal transduction. Undergoes a functional cycle that is linked to its ATPase activity. This cycle probably induces conformational changes in the client proteins, thereby causing their activation. Interacts dynamically with various co-chaperones that modulate its substrate recognition, ATPase cycle and chaperone function.

Molecular Weight: 83kDa

Peptide Sequence: Synthetic peptide located within the following region: NASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTK

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Heat shock protein HSP 90-beta

Protein Size: 724

Purification: Affinity Purified

• Artikelnummer: AVIARP58844_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58844_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 15516
• Wirt: Rabbit