HSPC111 Antibody - middle region : Biotin

Conjugation: Biotin

Description of Target: NOP16 is transcriptionally regulated by c-Myc (MYC; MIM 190080), upregulated in breast cancer, and overexpression is associated with poor patient survival (Butt et al., 2008).

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human HSPC111

Key Reference: Scherl,A., (2002) Mol. Biol. Cell 13 (11), 4100-4109

Molecular Weight: 21kDa

Peptide Sequence: Synthetic peptide located within the following region: RKVKAMEVDIEERPKELVRKPYVLNDLEAEASLPEKKGNTLSRDLIDYVR

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Nucleolar protein 16

Protein Size: 178

Purification: Affinity Purified

• Artikelnummer: AVIARP56898_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56898_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51491
• Wirt: Rabbit