IER5 Antibody - N-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: This gene encodes a protein that is similar to other immediate early response proteins. In the mouse, a similar gene may play an important role in mediating the cellular response to mitogenic signals. Studies in rats found the expression of a similar gene

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IER5

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: MEFKLEAHRIVSISLGKIYNSRVQRGGIKLHKNLLVSLVLRSARQVYLSD

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Immediate early response gene 5 protein

Protein Size: 327

Purification: Affinity Purified

• Artikelnummer: AVIARP56939_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP56939_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 51278
• Wirt: Rabbit