ISY1 Antibody - C-terminal region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: ISY1 may play a role in pre-mRNA splicing (Potential).

Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ISY1

Molecular Weight: 33kDa

Peptide Sequence: Synthetic peptide located within the following region: EKGGDDSQQKFIAHVPVPSQQEIEEALVRRKKMELLQKYASETLQAQSEE

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Size: 307

Purification: Affinity Purified

• Artikelnummer: AVIARP57838_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57838_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 57461
• Wirt: Rabbit