JARID2 Antibody - N-terminal region : FITC

JARID2 Antibody - N-terminal region : FITC
Artikelnummer
AVIARP58842_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene is an ortholog of the mouse jumonji gene, which encodes a nuclear protein essential for mouse embryogenesis, including neural tube formation. Overexpression of mouse jumonji negatively regulates cell proliferation. The jumonji proteins contain a

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human JARID2

Key Reference: Olsen,J.V., (2006) Cell 127 (3), 635-648

Molecular Weight: 139kDa

Peptide Sequence: Synthetic peptide located within the following region: THKHVHNGHVFNGSSRSTREKEPVQKHKSKEATPAKEKHSDHRADSRREQ

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protein Jumonji

Protein Size: 1246

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58842_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58842_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 3720
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×