JMJD2B Antibody - middle region : FITC

JMJD2B Antibody - middle region : FITC
Artikelnummer
AVIARP58207_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: JMJD2 family proteins are classified into one group with JD2H and TUDOR domains and another group without JD2H or TUDOR domains. Because JMJD2C gene (also known as GASC1 gene) is amplified in esophageal squamous cell carcinoma (ESCC), JMJD2 family genes are cancer-associated genes. Human genes corresponding to KIAA0677, KIAA0876, KIAA0780 and FLJ10251 cDNAs were designated JMJD2A, JMJD2B, JMJD2C, and JMJD2D, respectively. In addition, JMJD2D homologous genes within human genome sequences AP002383.3 and AP001264.4 were designated JMJD2E and JMJD2F, respectively. C2HC2HC2- and C5HC2-type Cys (His) clusters were identified as the region conserved among JMJD2A (1064 aa), JMJD2B (1096 aa), and JMJD2C (1056 aa) proteins. JMJD2A, JMJD2B and JMJD2C consist of JmjN, JmjC, JD2H, and two TUDOR domains.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human JMJD2B

Key Reference: Katoh,Y. (2007) Int. J. Mol. Med. 20 (2), 269-273

Molecular Weight: 122kDa

Peptide Sequence: Synthetic peptide located within the following region: SASRASLKAKLLRRSHRKRSQPKKPKPEDPKFPGEGTAGAALLEEAGGSV

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Lysine-specific demethylase 4B

Protein Size: 1096

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58207_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58207_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 23030
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×