KLHDC4 Antibody - N-terminal region : HRP

KLHDC4 Antibody - N-terminal region : HRP
Artikelnummer
AVIARP56977_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: The function of this protein remains unknown.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human KLHDC4

Key Reference: Segade,F., (2007) Int. J. Biochem. Cell Biol. 39 (12), 2303-2313

Molecular Weight: 58kDa

Peptide Sequence: Synthetic peptide located within the following region: MGKKGKKEKKGRGAEKTAAKMEKKVSKRSRKEEEDLEALIAHFQTLDAKR

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Kelch domain-containing protein 4

Protein Size: 520

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP56977_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP56977_P050-HRP
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 54758
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×