LCN8 Antibody - N-terminal region : Biotin

LCN8 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58490_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: The exact function of LCN8 is not known.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LCN8

Key Reference: Suzuki,K., Gene 339, 49-59 (2004)

Molecular Weight: 17kDa

Peptide Sequence: Synthetic peptide located within the following region: EELDRQKIGGFWREVGVASDQSLVLTAPKRVEGLFLTLSGSNLTVKVAYN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Epididymal-specific lipocalin-8

Protein Size: 152

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58490_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58490_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 138307
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×