LYRM1 Antibody - middle region : HRP

LYRM1 Antibody - middle region : HRP
Artikelnummer
AVIARP57413_P050-HRP
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: HRP: Horseradish Peroxidase

Description of Target: LYRM1 may promote cell proliferation and inhibition of apoptosis of preadipocytes.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LYRM1

Molecular Weight: 14kDa

Peptide Sequence: Synthetic peptide located within the following region: KEKQYILNEARTLFRKNKNLTDTDLIKQCIDECTARIEIGLHYKIPYPRP

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: LYR motif-containing protein 1

Protein Size: 122

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57413_P050-HRP
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57413_P050-HRP
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Goat (Caprine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57149
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×