MED14 Antibody - middle region : FITC

MED14 Antibody - middle region : FITC
Artikelnummer
AVIARP58139_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: The activation of gene transcription is a multistep process that is triggered by factors that recognize transcriptional enhancer sites in DNA. These factors work with co-activators to direct transcriptional initiation by the RNA polymerase II apparatus. The protein encoded by this gene is a subunit of the CRSP (cofactor required for SP1 activation) complex, which, along with TFIID, is required for efficient activation by SP1. This protein is also a component of other multisubunit complexes e.g. thyroid hormone receptor-(TR-) associated proteins which interact with TR and facilitate TR function on DNA templates in conjunction with initiation factors and cofactors. This protein contains a bipartite nuclear localization signal. This gene is known to escape chromosome X-inactivation.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MED14

Molecular Weight: 160kDa

Peptide Sequence: Synthetic peptide located within the following region: AADREDSPAMALLLQQFKENIQDLVFRTKTGKQTRTNAKRKLSDDPCPVE

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Mediator of RNA polymerase II transcription subunit 14

Protein Size: 1454

Purification: Affinity Purified

Subunit: 14
Mehr Informationen
Artikelnummer AVIARP58139_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58139_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rabbit
Klonalität Polyclonal
Methode Western Blotting, Chromatin Immunoprecipitation (ChIP)
Human Gene ID 9282
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×