MUC3B Antibody - N-terminal region : Biotin

MUC3B Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58395_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B

Key Reference: 0

Molecular Weight: 34kDa

Peptide Sequence: Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Size: 310

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58395_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58395_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 57876
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×