MYD88 Antibody - middle region : FITC

MYD88 Antibody - middle region : FITC
Artikelnummer
AVIARP58920_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MYD88

Key Reference: N/A

Molecular Weight: 27kDa

Peptide Sequence: Synthetic peptide located within the following region: AEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDD

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Myeloid differentiation primary response protein MyD88

Protein Size: 251

Purification: Affinity purified
Mehr Informationen
Artikelnummer AVIARP58920_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58920_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Sheep (Ovine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 4615
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×