English
PAFAH1B2 Antibody - N-terminal region : Biotin
PAFAH1B2 Antibody - N-terminal region : Biotin
Artikelnummer
AVIARP58507_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology
Verfügbarkeit:
wird geladen...
Preis wird geladen...
Conjugation: Biotin
Description of Target: Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript varia
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B2
Key Reference: Scott,B.T., Prostaglandins Other Lipid Mediat. 85 (3-4), 69-80 (2008)
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Platelet-activating factor acetylhydrolase IB subunit beta
Protein Size: 229
Purification: Affinity Purified
Subunit: beta
Description of Target: Platelet-activating factor acetylhydrolase (PAFAH) inactivates platelet-activating factor (PAF) into acetate and LYSO-PAF. This gene encodes the beta subunit of PAFAH, the other subunits are alpha and gamma. Multiple alternatively spliced transcript varia
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PAFAH1B2
Key Reference: Scott,B.T., Prostaglandins Other Lipid Mediat. 85 (3-4), 69-80 (2008)
Molecular Weight: 25kDa
Peptide Sequence: Synthetic peptide located within the following region: MSQGDSNPAAIPHAAEDIQGDDRWMSQHNRFVLDCKDKEPDVLFVGDSMV
Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
Protein Name: Platelet-activating factor acetylhydrolase IB subunit beta
Protein Size: 229
Purification: Affinity Purified
Subunit: beta
| Artikelnummer | AVIARP58507_P050-Btn |
|---|---|
| Hersteller | Aviva Systems Biology |
| Hersteller Artikelnummer | ARP58507_P050-Biotin |
| Green Labware | Nein |
| Verpackungseinheit | 100μl |
| Mengeneinheit | STK |
| Reaktivität | Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Horse (Equine) |
| Klonalität | Polyclonal |
| Methode | Western Blotting |
| Human Gene ID | 5049 |
| Wirt | Rabbit |
| Produktinformation (PDF) | Download |
| MSDS (PDF) |
|
Verwandte Artikel
Markieren Sie die Artikel, um Sie dem Warenkorb hinzuzufügen oder
Immer für Sie da
Gernot Ensinger, M.Sc.
