PDGFD Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: The protein encoded by this gene is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a core motif of eight cysteines, seven of which are f

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PDGFD

Key Reference: Liu,G., (2008) Hum. Pathol. 39 (3), 393-402

Molecular Weight: 40kDa

Peptide Sequence: Synthetic peptide located within the following region: NANLRRDESNHLTDLYRRDETIQVKGNGYVQSPRFPNSYPRNLLLTWRLH

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Platelet-derived growth factor D

Protein Size: 370

Purification: Affinity Purified

• Artikelnummer: AVIARP58814_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58814_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Rabbit, Guinea Pig, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 80310
• Wirt: Rabbit