PDS5B Antibody - middle region : HRP

Conjugation: HRP: Horseradish Peroxidase

Description of Target: PDS5B plays a role in androgen-induced proliferative arrest in prostate cells. It is required for maintenance of sister chromatid cohesion during mitosis. Defects in PDS5B may be the cause of some cancers including esophageal cancer.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDS5B

Key Reference: Gregory,S.G., (2006) Nature 441 (7091), 315-321

Molecular Weight: 159kDa

Peptide Sequence: Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK

Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.

Protein Name: Sister chromatid cohesion protein PDS5 homolog B

Protein Size: 1447

Purification: Affinity Purified

• Artikelnummer: AVIARP58313_P050-HRP
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP58313_P050-HRP
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Cow (Bovine), Zebrafish, Horse (Equine)
• Klonalität: Polyclonal
• Methode: Western Blotting
• Human Gene ID: 23047
• Wirt: Rabbit