PIWIL2 Antibody : FITC

PIWIL2 Antibody : FITC
Artikelnummer
AVIARP57108_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PIWIL2 belongs to the Argonaute family of proteins, which function in development and maintenance of germline stem cells (Sasaki et al., 2003 [PubMed 12906857]).

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PIWIL2

Key Reference: Lee,J.H., (2006) Hum. Mol. Genet. 15 (2), 201-211

Molecular Weight: 110kDa

Peptide Sequence: Synthetic peptide located within the following region: QVLELKSQRKTDSAEISIKIQMTKILEPCSDLCIPFYNVVFRRVMKLLDM

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Piwi-like protein 2

Protein Size: 973

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57108_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57108_P050-FITC
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55124
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×