PLSCR1 Antibody - N-terminal region : Biotin

Conjugation: Biotin

Description of Target: PLSCR1 may mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.PLSCR1 may play a central role in the initiation of fibrin clot formation, in the activation of mast cells and in the recognition of apoptotic and injured cells by the reticuloendothelial system.

Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PLSCR1

Molecular Weight: 35kDa

Peptide Sequence: Synthetic peptide located within the following region: MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPP

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Phospholipid scramblase 1

Protein Size: 318

Purification: Affinity Purified

• Artikelnummer: AVIARP57513_P050-Btn
• Hersteller: Aviva Systems Biology
• Hersteller Artikelnummer: ARP57513_P050-Biotin
• Green Labware: Nein
• Verpackungseinheit: 100μl
• Mengeneinheit: STK
• Reaktivität: Human
• Klonalität: Polyclonal
• Methode: Western Blotting, Immunohistochemistry
• Human Gene ID: 5359
• Wirt: Rabbit