PNRC2 Antibody - middle region : FITC

PNRC2 Antibody - middle region : FITC
Artikelnummer
AVIARP57028_P050FITC
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: FITC: Fluorescein Isothiocyanate

Description of Target: PNRC2 is involved in nonsense-mediated mRNA decay (NMD) by acting as a bridge between the mRNA decapping complex and the NMD machinery.PNRC2 may act by targeting the NMD machinery to the P-body and recruiting the decapping machinery to aberrant mRNAs. PNRC2 is required for UPF1/RENT1 localization to the P-body. PNRC2 also acts as a nuclear receptor coactivator. PNRC2 may play a role in controlling the energy balance between energy storage and energy expenditure.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PNRC2

Molecular Weight: 15kDa

Peptide Sequence: Synthetic peptide located within the following region: NQSWNSSLSGPRLLFKSQANQNYAGAKFSEPPSPSVLPKPPSHWVPVSFN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Proline-rich nuclear receptor coactivator 2

Protein Size: 139

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP57028_P050FITC
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP57028_P050-FITC
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 55629
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×