POT1 Antibody - middle region : Biotin

POT1 Antibody - middle region : Biotin
Artikelnummer
AVIARP58317_P050-Btn
Verpackungseinheit
100μl
Hersteller
Aviva Systems Biology

Verfügbarkeit: wird geladen...
Preis wird geladen...
Conjugation: Biotin

Description of Target: This gene is a member of the telombin family and encodes a nuclear protein involved in telomere maintenance. Specifically, this protein functions as a member of a multi-protein complex that binds to the TTAGGG repeats of telomeres, regulating telomere length and protecting chromosome ends from illegitimate recombination, catastrophic chromosome instability, and abnormal chromosome segregation. Increased transcriptional expression of this gene is associated with stomach carcinogenesis and its progression. Alternatively spliced transcript variants have been described.

Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POT1

Molecular Weight: 70kDa

Peptide Sequence: Synthetic peptide located within the following region: MNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN

Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.

Protein Name: Protection of telomeres protein 1

Protein Size: 634

Purification: Affinity Purified
Mehr Informationen
Artikelnummer AVIARP58317_P050-Btn
Hersteller Aviva Systems Biology
Hersteller Artikelnummer ARP58317_P050-Biotin
Green Labware Nein
Verpackungseinheit 100μl
Mengeneinheit STK
Reaktivität Human, Mouse (Murine), Rat (Rattus), Pig (Porcine), Rabbit, Dog (Canine), Guinea Pig, Cow (Bovine), Zebrafish, Horse (Equine)
Klonalität Polyclonal
Methode Western Blotting
Human Gene ID 25913
Wirt Rabbit
Produktinformation (PDF) Download
MSDS (PDF)
×